PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G267200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 402aa    MW: 44896.1 Da    PI: 6.8135
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G267200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.44.8e-11114151643
                         HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNk 43 
                         + rr+++NReAAr+sR+RKka+i++Le+   +L +  +
  Sevir.7G267200.1.p 114 VLRRLAQNREAARKSRLRKKAYIQQLETSRMKLAQLEQ 151
                         679************************86555554444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-7109173IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.048111155IPR004827Basic-leucine zipper domain
PfamPF001708.7E-8113152IPR004827Basic-leucine zipper domain
CDDcd147087.24E-21113162No hitNo description
Gene3DG3DSA:1.20.5.1709.1E-8115158No hitNo description
SuperFamilySSF579591.13E-6115157No hitNo description
PROSITE patternPS000360116131IPR004827Basic-leucine zipper domain
PfamPF141441.7E-29199274IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MMELYHGYLE DHFNLHKLSI GSAASPPEFM TSASAVQFAA VPVRMGVYER PAPAPVMGMW  60
NSDPFKVDSG QATSGSTVME ADKKFDNRLE DVPQVALEPA RSTDQETSRP PERVLRRLAQ  120
NREAARKSRL RKKAYIQQLE TSRMKLAQLE QELQRARQQG AYANGNMGDS TLGFTGPMDP  180
GVAGFEIDYS NWVEEQNRHT AELRSALQGQ PSELELRTLV ETGLNNYEHL FRIKALAANA  240
DVFYVMSGMW KTPAERFFLW IGGFRPSEVL KILRPQLEPL TEPQLMAVGG LQHTSTQAED  300
ALSQGMEKLQ QNLAETLTAA ADPFGLPDGY MLQMATAVEK LKELVGFVTQ ADHLRQTTMQ  360
QMHKILTTRQ AARGLLALGD YFQRLRALSH LWATRREAAI S*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976974.10.0PREDICTED: transcription factor TGA4-like isoform X1
SwissprotQ391621e-137TGA4_ARATH; Transcription factor TGA4
TrEMBLK3Y7I60.0K3Y7I6_SETIT; Uncharacterized protein
STRINGSi010177m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35713877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-129TGACG motif-binding factor 4